Content-type: text/html SPARKS-X result for test

SPARKS-X result for test

Your input sequence:
RGSATDTAATTGTASPDEPLYVQGQTELDDVTSDNDVVLADFYADWCGPCQMLEPVVETLAEQTDAAVAKIDVDENQALASAYGVRGVPTLVLFADGEQVEEVVGLQDEDALKDLIESYTELVP

--------------------------------------------------------------------------
TOP  10  MATCHES (Zscore>6 means significant matching)
--------------------------------------------------------------------------
RANK  TEMPLATE   ZSCORE   SEQID   ALIGNMENT    MODEL
--------------------------------------------------------------------------

 1 4xhmA  19.65 31.5% [ALI1] [MOD1]
2 2yj7A 19.06 39.0% [ALI2] [MOD2]
3 2i4aA 19.01 34.6% [ALI3] [MOD3]
4 2cvkA 18.93 38.7% [ALI4] [MOD4]
5 1thxA 18.85 25.0% [ALI5] [MOD5]
6 1t00A 18.79 29.5% [ALI6] [MOD6]
7 1dbyA 18.69 31.8% [ALI7] [MOD7]
8 3hhvA 18.61 29.8% [ALI8] [MOD8]
9 3tcoA 18.54 35.5% [ALI9] [MOD9]
10 4wxtA 18.53 37.0% [ALI10] [MOD10]
-------------------------------------------------------------------------- Thu Jan 16 11:21:42 2020

Please contact Tom Litfin if any questions/comments.