SPOT-disorder result for test

The Predicted disorder for test (The first sequence if multiple sequences):

The SPOT-disorder results for all sequences can be downloaded from the file, 
and the SPIDER2/HSE/PSSM prediction can be downloaded from the file,

Warnings in the output:
None

Below list disorder status, Secondary structure, accessible surface area rASA - the relative ASA [0,9]; (Buried residues with rASA <20% are labelled blue) SPOD - the disorder status: threshold=0.46) >Example: 6KIL_A SEQ : 1 RGSATDTAATTGTASPDEPLYVQGQTELDDVTSDNDVVLADFYADWCGPC 50 SPOD: 1 DDDDDDDDDDDDDDDDD--------------------------------- 50 SS : 1 -------------------EEE--H--HHHH------EEEEEE-----HH 50 rASA: 1 78876765666665447431415456335512566410000011520220 50 SEQ : 51 QMLEPVVETLAEQTDAAVAKIDVDENQALASAYGVRGVPTLVLFADGEQV 100 SPOD: 51 -------------------------------------------------- 100 SS : 51 H-HHHHHHHHHHH---EEEEEE----HHHHHH-------EEEEEE--EEE 100 rASA: 51 33123103301751702103031452552075251421110001275642 100 SEQ : 101 EEVVGLQDEDALKDLIESYTELVP 124 SPOD: 101 ---------------------DDD 124 SS : 101 EEEEE---HHHHHHHHHHH----- 124 rASA: 101 442333453730362056237557 124
Note: use command "tar ztvf spotd.tgz" or similar to unzip the file in linux
Fri Jan 31 10:39:31 2020